General Information

  • ID:  hor006790
  • Uniprot ID:  A0A0F7YI5
  • Protein name:  Thyrostimulin beta-5 subunit
  • Gene name:  NA
  • Organism:  Conus victoriae
  • Family:  Glycoprotein hormones subunit alpha family
  • Source:  Human
  • Expression:  Expressed by the venom duct.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Caenogastropoda; Neogastropoda; Conoidea; Conidae (cone shells); Conus; Cylinder; Conus victoriae (Queen Victoria cone)
  • GO MF:  GO:0005737 cytoplasm; GO:0005615 extracellular space
  • GO BP:  GO:0090729 toxin activity; GO:0005179 hormone activity
  • GO CC:  GO:0007186 G protein-coupled receptor signaling pathway

Sequence Information

  • Sequence:  LVDPRTTLQCHVRSYTFRATKPPIVNENGDPVTCQGDVRVSSCWGRCDSSEIGDYKMPFKISNHPVCTYTGRVSRTVRLSQCAGYPDPTVQVFDATGCACQFCNSETQLCEKLNG
  • Length:  115
  • Propeptide:  MVMPLVLSLALTPPPLCHATLVDPRTTLQCHVRSYTFRATKPPIVNENGDPVTCQGDVRVSSCWGRCDSSEIGDYKMPFKISNHPVCTYTGRVSRTVRLSQCAGYPDPTVQVFDATGCACQFCNSETQLCEKLNG
  • Signal peptide:  MVMPLVLSLALTPPPLCHA
  • Modification:  T159 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  thyrostimulin influences body metabolism, via stimulation of the thyrotropin G protein-coupled receptor
  • Mechanism:  thyrostimulin influences body metabolism, via stimulation of the thyrotropin G protein-coupled receptor
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA